Biocomputing group - University of Bologna

Job title: GM0510

Job code: tMFO3def - Submitted by Anonymous on 2026-07-21 07:53:28

Sequence name:

GM0510

Submitted sequence:

MKALVAVSAVAVVVALLGVSSAQADPEADPGAGEANYGGPPSSPRLVDHTEWAQWGSLPS
LRVYPSQVGRTASRRLGMAAADAAWAEVLALSPEADTAGMRAQFICHWQIIRQPSWNLEP
WRPVDDSEMLASGCNPGSPEESF

Prediction status: completed

Prediction summary:

Cell Membrane, Globular

WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.

Detailed prediction results

Predicted membrane localization (MemLoci): Cell Membrane

Cell membrane score: 88%
Internal membrane score: -93%
Organelle membrane score: 51%

Predicted sequence features:

PredictionPresenceStartEndDetail
Signal peptide (SPEP):YES122view on sequence
Transmembrane region (ENSEMBLE):NO--not present
GPI anchor (PredGPI):NO--not present

Annotation of similar proteins in SwissProt

loading...