Job title:
Job code: be0UXmaj - Submitted by Anonymous on 2019-10-24 08:43:24
Sequence name:
1
Submitted sequence:
FWTRYGHYEFLVMSFGLTNAPAAFMELMNRVF
Prediction status: completed
Prediction summary:
Organelle membranes, Globular
WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.
Detailed prediction results
Predicted membrane localization (MemLoci): Organelle membranes
Predicted sequence features:
Prediction | Presence | Start | End | Detail |
---|---|---|---|---|
Signal peptide (SPEP): | NO | - | - | not present |
Transmembrane region (ENSEMBLE): | NO | - | - | not present |
GPI anchor (PredGPI): | NO | - | - | not present |