Biocomputing group - University of Bologna

Job title:

Job code: be0UXmaj - Submitted by Anonymous on 2019-10-24 08:43:24

Sequence name:

1

Submitted sequence:

MHMCIDYRQLNKVIVKNKYPLPXIDDLFDQLQGALVFLKIDLRFGYHQLRIRASDIPKTT
FWTRYGHYEFLVMSFGLTNAPAAFMELMNRVF

Prediction status: completed

Prediction summary:

Organelle membranes, Globular

WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.

Detailed prediction results

Predicted membrane localization (MemLoci): Organelle membranes

Cell membrane score: -91%
Internal membrane score: 68%
Organelle membrane score: 87%

Predicted sequence features:

PredictionPresenceStartEndDetail
Signal peptide (SPEP):NO--not present
Transmembrane region (ENSEMBLE):NO--not present
GPI anchor (PredGPI):NO--not present

Annotation of similar proteins in SwissProt

loading...