Biocomputing group - University of Bologna

Job title:

Job code: YKNdmyZH - Submitted by Anonymous on 2021-02-08 10:10:00

Sequence name:

IFNG

Submitted sequence:

MKVLILACLVALALAQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIM
QSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNV
QRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Prediction status: completed

Prediction summary:

Internal membranes, Globular

WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.

Detailed prediction results

Predicted membrane localization (MemLoci): Internal membranes

Cell membrane score: -53%
Internal membrane score: 97%
Organelle membrane score: 54%

Predicted sequence features:

PredictionPresenceStartEndDetail
Signal peptide (SPEP):YES115view on sequence
Transmembrane region (ENSEMBLE):NO--not present
GPI anchor (PredGPI):NO--not present

Annotation of similar proteins in SwissProt

loading...