Biocomputing group - University of Bologna

Job title: 1

Job code: VkTgHLP1 - Submitted by Anonymous on 2025-12-16 08:06:39

Sequence name:

2108

Submitted sequence:

MRKALSSAIFLIIMLIVLLSVLIPALLIFNSTPIYSSQGQIAGTGYQQLQKNEENQVFRG
NPNIYYNSSLMPYIEFLYNSIPYPLNITQIYYFNGSTWVPALKNSILIAGNQNIYLPRAA
FNQPILIVSSQANFYFLNPNTSVTTVTCG*

Prediction status: completed

Prediction summary:

Internal membranes, Globular

WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.

Detailed prediction results

Predicted membrane localization (MemLoci): Internal membranes

Cell membrane score: -46%
Internal membrane score: 49%
Organelle membrane score: 64%

Predicted sequence features:

PredictionPresenceStartEndDetail
Signal peptide (SPEP):YES136view on sequence
Transmembrane region (ENSEMBLE):NO--not present
GPI anchor (PredGPI):NO--not present

Annotation of similar proteins in SwissProt

loading...