Job title: OsHIPP17
Job code: UnR9fGtm - Submitted by Anonymous on 2026-06-14 12:11:12
Sequence name:
OS09T0272000-01
Submitted sequence:
AELLSVSSGDDKKMGGGGGHGGMGMGFGGGHGGMGFGGGHGGKEGKEGGGKVVVDGVHHH
HQQQLQQQHAMAPPMQPYPAAPAYYNAAAPSYPVYPSYAGYPQQEQDPGCSIM
Prediction status: completed
Prediction summary:
Organelle membranes, Globular
WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.
Detailed prediction results
Predicted membrane localization (MemLoci): Organelle membranes
Predicted sequence features:
| Prediction | Presence | Start | End | Detail |
|---|---|---|---|---|
| Signal peptide (SPEP): | NO | - | - | not present |
| Transmembrane region (ENSEMBLE): | NO | - | - | not present |
| GPI anchor (PredGPI): | NO | - | - | not present |