Job title:
Job code: KqgyX9EH - Submitted by Anonymous on 2024-12-15 08:54:08
Sequence name:
CA2
Submitted sequence:
SADDPDRNSLKIDYSPLKGVSMSIENTGHGWQLNIPDQYAQECPITGGHLRNDHYRLLQI
HAHWGKNCSNGSEHTINGKSYPSEIHLVHWNVSKYSTPIEAQNNSKDGLAVIGVFVQLCQ
TPHPILTMIDSLLPSIPFKGDKKMVQNGEMDLNLLIPDRHSPNYWFYLGSLTTPPFSESV
LWFVMKTPIRASESQIVAFRQLYSRERNEHSNHLVDENFRDVQDRNNRAIVDVNYD
Prediction status: completed
Prediction summary:
Internal membranes, Globular
WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.
Detailed prediction results
Predicted membrane localization (MemLoci): Internal membranes
Predicted sequence features:
Prediction | Presence | Start | End | Detail |
---|---|---|---|---|
Signal peptide (SPEP): | NO | - | - | not present |
Transmembrane region (ENSEMBLE): | NO | - | - | not present |
GPI anchor (PredGPI): | NO | - | - | not present |