Job title: 1
Job code: K9pvkH8o - Submitted by Anonymous on 2025-11-21 10:16:03
Sequence name:
OS08T0403300-00
Submitted sequence:
INRKQQKVTVQGMVDTQRVLRRAQSTGKRTELWPYVPYTNPYVAPPAAYDKKAPNGHIRR
VDAVLPVTPSQEERLATLFSDDNPNACAVM
Prediction status: completed
Prediction summary:
Cell Membrane, Globular
WARNING: This protein is predicted not to be an integral membrane protein, since it do not contain tranmsmebrane or GPI-anchored domains. The prediction of the localization has to be considered only if other evidences of membrane association are available. For a hint, please have a look at the annotation extracted from similar proteins, as reported below.
Detailed prediction results
Predicted membrane localization (MemLoci): Cell Membrane
Predicted sequence features:
| Prediction | Presence | Start | End | Detail |
|---|---|---|---|---|
| Signal peptide (SPEP): | NO | - | - | not present |
| Transmembrane region (ENSEMBLE): | NO | - | - | not present |
| GPI anchor (PredGPI): | NO | - | - | not present |