Biocomputing group - University of Bologna

Job title: ORF6

Job code: Gv96EDgY - Submitted by Anonymous on 2024-10-08 09:19:41

Sequence name:

GI||GB|| []

Submitted sequence:

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEI
D

Prediction status: completed

Prediction summary:

Internal membranes, 1 Transmembrane helix

Detailed prediction results

Predicted membrane localization (MemLoci): Internal membranes

Cell membrane score: -90%
Internal membrane score: 90%
Organelle membrane score: 47%

Predicted sequence features:

PredictionPresenceStartEndDetail
Signal peptide (SPEP):NO--not present
Non cytoplasmic region (ENSEMBLE):-17view on sequence
Transmembrane region (ENSEMBLE):YES836view on sequence
Cytoplasmic region (ENSEMBLE):-3761view on sequence
GPI anchor (PredGPI):NO--not present

Annotation of similar proteins in SwissProt

loading...